PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00012040001
Common NameGSBRNA2T00012040001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 394aa    MW: 44222.4 Da    PI: 6.4015
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00012040001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.2e-344599155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wtp+LHerFv+av+qLGG ekAtPkti+++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00012040001 45 KPRLKWTPDLHERFVDAVNQLGGGEKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 99
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3842102IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-3243100IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2345100IPR006447Myb domain, plants
PfamPF002491.8E-104798IPR001005SANT/Myb domain
PfamPF143793.0E-25146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MYYHNQHQGK SILSSSRMSI PSERHPFLRG NGPGDSGLIL STDAKPRLKW TPDLHERFVD  60
AVNQLGGGEK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANSS LNKTSVMTMV  120
EENTPEADES HSESLSIGPQ PSMNLPISDA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQAILEKAQ ETLGRQNLGP AGIEATKAQL SELVSKVSSE YPDASFLELQ NLHHQQMQTA  240
YPPPNSSLES CLTSSEGNQK APKMLENGLG LRTYLGDSSS EQKEIMEEPF FHRMELTWAA  300
EEEEEGFREN NNRPYLSAME PRNSTSRRSP GRLSIGVGLQ EHRGGYTEER YRENGGDCKV  360
ETRTSTALDL NTHEETYGTT RPKQFDLNSF SWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0428780.0AY042878.1 Arabidopsis thaliana transfactor-like protein (MRG7.19) mRNA, complete cds.
GenBankBT0034210.0BT003421.1 Arabidopsis thaliana transfactor-like protein (At5g18240) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687425.10.0PREDICTED: myb family transcription factor APL-like isoform X1
RefseqXP_013687424.10.0PREDICTED: myb family transcription factor APL-like isoform X1
TrEMBLA0A078IVN40.0A0A078IVN4_BRANA; BnaC09g54190D protein
STRINGBra002145.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.40.0myb-related protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]